Levering fra 38,-
Landsdækkende bytteservice
Barebells

Barebells - Proteinshake 330 ml - jordbærsmag

Varenr. 1807

  • 24 g. protein
  • Jordbærsmag
  • 330 ml
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 15:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
19,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord