Levering fra 38,-
Landsdækkende bytteservice

Chrisco - Tropisk basisfoder 20 g

Varenr. 18883

  • Højt protein indhold
  • Til tropiske fisk
  • 20 g
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 19:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
19,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord