Levering fra 38,-
Landsdækkende bytteservice
High5

HIGH5 energidrik/-pulver - citrus og koffein 2,2kg

Varenr. 9962

  • Protein og kulhydrater
  • Indeholder koffein
  • Til før og under træning
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 11:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
249,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord