Levering fra 38,-
Landsdækkende bytteservice
High5

HIGH5 recoverybar - chokolade 50 g

Varenr. 9947

  • Velsmagende sportsbar
  • Efter træning
  • 22 g. kulhydrat/14 g. protein
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 19:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
13,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord