Levering fra 29,-
Landsdækkende bytteservice
High5

HIGH5 recoverybar 50 g - chokolade

Varenr. 9947

  • Velsmagende sportsbar
  • Efter træning
  • 22 g. kulhydrat/14 g. protein
Læs mere
På lager i webshop
På lager i alle butikker
Opdateret kl. 10:50
Leveringstid: 2-3 hverdage.
Levering fra 29 kr.
13,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord