Levering fra 38,-
Landsdækkende bytteservice
High5

HIGH5 recoverydrik - chokoladesmag 60 g

Varenr. 9875

  • Protein og kulhydrater
  • Hurtigere restitution
  • Til brug efter træning
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 15:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
17,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord