Levering fra 29,-
Landsdækkende bytteservice
Faunakram

Kattefoder til steriliseret kat med kylling og laks - 3 kg

Varenr. 13353

  • Kornfri
  • 31% protein
  • Smart genlukspose
Læs mere
På lager i webshop
På lager i alle butikker
Opdateret kl. 18:50
Leveringstid: 2-3 hverdage.
Levering fra 29 kr.
99,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord