Levering fra 29,-
Landsdækkende bytteservice

Leversnitter 2 kg

Varenr. 9616

  • Naturlige ingredienser
  • Indeholder vitamin A, D og E
  • Med 65% protein
Læs mere
På lager i webshop
På lager i alle butikker
Opdateret kl. 18:50
Leveringstid: 1-3 hverdage.
Levering fra 45 kr.
44,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Tilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestromobilepaynetsdanske-fragtmaendglspostnord