Levering fra 38,-
Landsdækkende bytteservice

Leversnitter 2 kg

Varenr. 9616

  • Naturlige ingredienser
  • Indeholder vitamin A, D og E
  • Med 65% protein
Læs mere
Midlertidig udsolgt i webshop - forventes på lager 12/10-2021
På lager i de fleste butikker - se lagerstatus i din butik
Opdateret kl. 19:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
49,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord