Levering fra 29,-
Landsdækkende bytteservice
Barebells

Barebells proteinbar 55 g - Caramel Cashew

Varenr. 9324

  • Lav på kalorier
  • Indeholder 20 g protein
  • Uden tilsat sukker
  • Julegaver byttes frem til 31. januar
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 14:55
Leveringstid: 3-4 hverdage.
Levering fra 29 kr.
19,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

pris garanti
dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord