Levering fra 29,-
Landsdækkende bytteservice
Barebells

Barebells proteinbar 55 g - Caramel-Cashew

Varenr. 9324

  • Lav på kalorier
  • Indeholder 20 g protein
  • Uden tilsat sukker
Læs mere
På lager i webshop
På lager i alle butikker
Opdateret kl. 18:50
Leveringstid: 1-3 hverdage.
Levering fra 45 kr.
19,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Tilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestromobilepaynetsdanske-fragtmaendglspostnord