Levering fra 38,-
Landsdækkende bytteservice
Barebells

Barebells proteinbar - Hazelnut og nougat 55 g

Varenr. 9963

  • Lav på kalorier
  • Indeholder 20 g protein
  • Uden tilsat sukker
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 19:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
14,95 kr
19,95 Du sparer 5,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord