Levering fra 29,-
Landsdækkende bytteservice
Barebells

Barebells proteinbar 55 g - Hazelnut & Nougat

Varenr. 9963

  • Lav på kalorier
  • Indeholder 20 g protein
  • Uden tilsat sukker
Læs mere
På lager i webshop
På lager i alle butikker
Opdateret kl. 18:50
Leveringstid: 2-3 hverdage.
Levering fra 29 kr.
10,00 kr
19,95 Du sparer 9,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord