Levering fra 38,-
Landsdækkende bytteservice
Barebells

Barebells - Proteinbar 55g- white chocolate almond

Varenr. 9697

  • Lav på kalorier
  • Indeholder 20 g protein
  • Uden tilsat sukker
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 19:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
19,95 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord