På grund af ekstraordinær travlhed kan bestillinger afgivet fra mandag 6. april først leveres efter påske.
Levering fra 29,-
Landsdækkende bytteservice
Barebells

Barebells proteinbar 55 g - White Chocolate Almond

Varenr. 9697

  • Lav på kalorier
  • Indeholder 20 g protein
  • Uden tilsat sukker
Læs mere
Midlertidig udsolgt i webshop - forventes på lager 21/4-2020
På lager i de fleste butikker
Opdateret kl. 18:50
Leveringstid: 1-3 hverdage.
Levering fra 29 kr.
9,95 kr
19,95 Du sparer 10,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Tilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestromobilepaynetsdanske-fragtmaendglspostnord