Levering fra 29,-
Landsdækkende bytteservice

Spil - SEQUENCE

Varenr. 12518

  • 5 på stribe
  • Brætspil
  • Antal spillere: 2 - 12
  • Julegaver byttes frem til 31. januar
Læs mere
Midlertidig udsolgt i webshop - forventes på lager 24/12-2020
På lager i få butikker - se lagerstatus i din butik
Opdateret kl. 10:55
Leveringstid: 3-4 hverdage.
Levering fra 29 kr.
178,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

pris garanti
dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord