På grund af ekstraordinær travlhed er der i øjeblikket 5 - 6 hverdages leveringstid.
Levering fra 29,-
Landsdækkende bytteservice

Spil - SEQUENCE

Varenr. 12518

  • 5 på stribe
  • Brætspil
  • Antal spillere: 2-12
Læs mere
Midlertidig udsolgt i webshop - forventes på lager 4/8-2020
På lager i få butikker
Opdateret kl. 7:50
Leveringstid: 5-6 hverdage.
Levering fra 29 kr.
178,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Tilføj favoritter

Andre har også købt

Andre kiggede også på

pris garanti
dankortvisa-electronvisamastercardmaestromobilepaynetsdanske-fragtmaendglspostnord