Levering fra 38,-
Landsdækkende bytteservice

Spil - SEQUENCE

Varenr. 12518

  • 5 på stribe
  • Brætspil
  • Antal spillere: 2 - 12
Læs mere
På lager i webshop
På lager i alle butikker - se lagerstatus i din butik
Opdateret kl. 19:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
178,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord