Levering fra 38,-
Landsdækkende bytteservice

Spil - SEQUENCE

Varenr. 12518

  • 5 på stribe
  • Brætspil
  • Antal spillere: 2 - 12
Læs mere
Midlertidig udsolgt i webshop - forventes på lager 7/7-2021
På lager i få butikker - se lagerstatus i din butik
Opdateret kl. 18:45
Leveringstid: 1-3 hverdage.
Levering fra 38 kr.
178,00 kr
facebook sharetwitter sharepinterest sharelinkedin shareemail share
Fjern fra favoritterTilføj favoritter

Andre har også købt

Andre kiggede også på

Sidst sete produkter

dankortvisa-electronvisamastercardmaestroikano-bankmobilepaynetsdanske-fragtmaendglspostnord